PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0157900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 176aa    MW: 19436.8 Da    PI: 9.408
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0157900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.7e-144387348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +W+++Ed+ll + v  +G ++W++Ia+ +   +t+ qc+ rw++yl
   Spipo0G0157900 43 SWSQQEDDLLREQVGIHGIENWTSIAAQFK-DKTGRQCRRRWFTYL 87
                     6****************************9.*************97 PP

2Myb_DNA-binding48.42.2e-1593137147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g W++eEd ll +a k +G++ W+ Ia+ +  gRt++ +k+r++++
   Spipo0G0157900  93 KGGWSPEEDALLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFNTL 137
                      688*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.6693687IPR017930Myb domain
SMARTSM007171.2E-114089IPR001005SANT/Myb domain
SuperFamilySSF466892.28E-2740134IPR009057Homeodomain-like
CDDcd001674.55E-114387No hitNo description
PfamPF139212.7E-1444104No hitNo description
Gene3DG3DSA:1.10.10.606.3E-214494IPR009057Homeodomain-like
PROSITE profilePS5129421.11888142IPR017930Myb domain
SMARTSM007171.1E-1592140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-2295143IPR009057Homeodomain-like
CDDcd001676.56E-1196137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MERTGEEAAR EVAAAGGDGG DGGSGGGRGR GVAPQQKERH VVSWSQQEDD LLREQVGIHG  60
IENWTSIAAQ FKDKTGRQCR RRWFTYLNTE CKKGGWSPEE DALLCEAQKI FGNRWTEIAK  120
VVSGRTDNAV KNRFNTLCKK RLKQEAMTKE NTPHCARSGM EISAFKLVSA QNPRV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-304414210108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008780751.12e-70PREDICTED: transcription factor MYB34
TrEMBLM1CEK68e-69M1CEK6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000657971e-67(Solanum tuberosum)
STRINGVIT_01s0026g01910.t012e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89033847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.26e-65MYB family protein